PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo26G0003700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family CPP
Protein Properties Length: 512aa    MW: 55149.1 Da    PI: 7.1028
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo26G0003700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.91.3e-155190241
              TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                     +k++CnCk+skClk+YCeCfa+g++C++ C+C +C+N+ e
  Spipo26G0003700 51 KKRQCNCKNSKCLKLYCECFASGSYCGDGCNCVNCHNNIE 90
                     799**********************************976 PP

2TCR47.53.5e-15134173140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgCnCkks ClkkYCeCf+a+  Cse+CkC dCkN e
  Spipo26G0003700 134 KHNKGCNCKKSGCLKKYCECFQANILCSENCKCCDCKNFE 173
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.3E-175091IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.07451174IPR005172CRC domain
PfamPF036383.4E-125388IPR005172CRC domain
SMARTSM011142.3E-17134175IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.6E-11137172IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MALAIFDIFG SFLEDHIAWF SYHWCKTARK PDSPKPHPRP GFEVKDGTPK KKRQCNCKNS  60
KCLKLYCECF ASGSYCGDGC NCVNCHNNIE NEAARHEAVE ATLERNPNAF RPKIASSPPA  120
IRDSREAELP LLGKHNKGCN CKKSGCLKKY CECFQANILC SENCKCCDCK NFEGSEERRA  180
LFHGDHGRNI AYAQQAANAA ITGAIGSSGY GSSPASKKRK NQEALFAPGL KDPTIQKLAQ  240
FPQVNTLKNP SPSSLGFMPA RAGNPPGTGS TKVTYRPLLA DIIQPEDVKE LCKLLVVVSG  300
EAARALAEKD EEEKAAESED RTSTTCASPA QNRDEHLKEP YGQIRSGNEH PNGGKADIMA  360
TESEQDGPEV QGGGRPMSPG TLALMCDEQD SMFMASSSQN AAASTRFPSG QSMPEIYIEQ  420
ERCILTEFRD CLRNLVTYGK IKESKYSSMA TQSDASGLQE AVTGGIPRPS IPSSSGVVQN  480
AIFGAVPFSS CKPPKAGPPG VDNELDALAA E*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4840281e-46AM484028.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X101832.7, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924583.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
RefseqXP_010249672.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-155TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0K9NTR30.0A0A0K9NTR3_Z
STRINGVIT_11s0016g03680.t011e-178(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47303657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-130Tesmin/TSO1-like CXC domain-containing protein